PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G13130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 328aa    MW: 35232.9 Da    PI: 4.7416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G13130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWTteEde+l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
  OMERI03G13130.1 14 RGRWTTEEDEKLAGYIAKHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding49.11.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  OMERI03G13130.1  67 RGNISNQEEDVIIKLHATLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      788999****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.249961IPR017930Myb domain
SuperFamilySSF466892.62E-2811108IPR009057Homeodomain-like
SMARTSM007171.7E-111363IPR001005SANT/Myb domain
PfamPF002499.2E-161461IPR001005SANT/Myb domain
CDDcd001672.50E-101661No hitNo description
PROSITE profilePS5129423.63262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2465116IPR009057Homeodomain-like
SMARTSM007171.2E-1566114IPR001005SANT/Myb domain
PfamPF002494.1E-1467112IPR001005SANT/Myb domain
CDDcd001671.72E-1171112No hitNo description
PfamPF066405.2E-79130328IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTTE EDEKLAGYIA KHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRAGVKRGNI SNQEEDVIIK LHATLGNRWS LIASHLPGRT DNEIKNYWNS HLSRQIHTYR  120
RTHTAPSEAA VTIDVTKLQA AGKRRGGRTA GQSRKGDKKR AEDDPPKETA AADTPLPESS  180
PPRAQSDEAR SGSVVVDPEE PSSQPNNGSS GGTPDGPCSE ETTTGPTSLD PIEMGLWEAE  240
SEFAEMEALL CGGVAPDGPG IPGLEPLDVA AQADDLLDMD WDGFAADLWG DPAQRGGLVQ  300
DAGEPNGSMG CSSDELESFA SWLLSDSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24121185110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1372670.0AC137267.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0032G21, from chromosome 3, complete sequence.
GenBankAF4741410.0AF474141.1 Oryza sativa typical A-type R2R3 Myb protein gene, complete cds.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629329.10.0PREDICTED: myb-related protein P-like
SwissprotP278988e-93MYBP_MAIZE; Myb-related protein P
TrEMBLA0A0E0CZF00.0A0A0E0CZF0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA010900-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-68myb domain protein 12